Instructions: Enter a transcription factor record in Transfac format or select from samples below. When done, click on the SUBMIT button. The script will extract individual data elements from your input.

TRANSCRIPTION FACTOR ENTRY:

Sample Input:

AC T00004 XX ID T00004 XX DT 20.10.92 (created); ewi. DT 08.05.96 (updated); ewi. XX FA Sc XX SY AS-C T4; Achaete-Scute T4; Scute; Sis-b; Sisterless-b; XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; OC diptera; drosophiloidea; drosophilidae XX CL C0010; bHLH; 1.2.3.0.2. XX SZ 345 AA; 38.1 kDa (gene) XX SQ MKNNNNTTKSTTMSSSVLSTNETFPTTINSATKIFRYQHIMPAPSPLIPGGNQNQPAGTM SQ PIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFA SQ RLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRSLQDLVDDLNGGSNIGANNA SQ VTQLQLCLDESSSHSSSSSTCSSSGHNTYYQNRISVSPVQQQQQLQRQQFNHQPLTALSL SQ NTNLVGTSVPGGDAGCVSTSKNQQTCHSPTSSFNSSMSFDSGTYEGVPQQISTHLDRLDH SQ LDNELHTHSQLQLKFEPYEHFQLDEEDCTPDDEEILDYISLWQEQ XX SC SwissProt #P10084 XX FT 103 111 basic region FT 112 163 helix-loop-helix domain FT 191 204 serine-rich region (11/14) FT 220 233 glutamine-rich region (9/14) FT 324 337 acidic region (9/14) XX SF 5th Met codon revealing better match with Kozak rules SF would give rise a 274 AA peptide of 30.4 kDa [9]; SF heterodimerization with Da required for efficient DNA-binding [1], [8]; XX CP nervous system - proneural clusters of imaginal disks CN neurons [2]; XX FF (co-)regulator of neurogenesis, involved in segregation FF of neural lineages from epidermal precursors [9]; FF expressed in cells delimiting sensory mother cell areas [4]; FF one cell per group with highest Ac and Sc levels becomes FF a sensory mother cell [4]; FF directing the morphogen Dorsal to target genes in FF lateral regions of the embryo by cooperative DNA-binding [7]; FF numerator in the sex-determining X:A ratio; FF expression domains are first complementary to those FF of Ac, then identical due to mutual induction [5], [6]; FF antagonized and down-regulated by Emc [10], [4]; FF repressed by Hairy in a spatially and temporally different pattern [6]; XX IN T01034; Da; fruit fly, Drosophila melanogaster. XX BS R03719; DROME$AC_01; Quality: 6; fruit fly, Drosophila melanogaster BS R03718; DROME$HB_12; Quality: 6; fruit fly, Drosophila melanogaster XX DR EMBL: M17119; DMACS2(g). DR SwissProt: P10084; AST4_DROME. DR Flybase: FBgn0004170; sc. XX RN [1] RA Cabrera C. V., Alonso M. C. RT Transcriptional activation by heterodimers of the RT achaete-scute and daughterless gene products of Drosophila RL EMBO J. 10:2965-2973 (1991). RN [2] RA Cabrera C. V., Martinez-Arias A., Bate M. RT The expression of three members of the achaete-scute RT gene complex correlates with neuroblast segregation in Drosophila RL Cell 50:425-433 (1987). RN [3] RA Campuzano S., Carramolino L., Cabrera C. V., Ruiz-G�mez RA M., Villares R., Boronat A., Modolell J. RT Molecular genetics of the achaete-scute gene complex of D. Melanogaster RL Cell 40:327-338 (1985). RN [4] RA Cubas P., de Celis J.-F., Campuzano S., Modolell J. RT Proneural clusters of achaete-scute expression and RT the generation of sensory organs in the Drosophila imaginal wing disc RL Genes Dev. 5:996-1008 (1991). RN [5] RA Martinez C., Modolell J. RT Cross-regulatory interactions between the proneural RT achaete and scute genes of Drosophila RL Science 251:1485-1487 (1991). RN [6] RA Skeath J. B., Carroll S. B. RT Regulation of achaete-scute gene expression and sensory RT organ pattern formation in the Drosophila wing RL Genes Dev. 5:984-995 (1991). RN [7] RA Jiang J., Levine M. RT Binding affinities and cooperative interactions with RT bHLH activators delimit threshold responses to the dorsal gradient morphogen RL Cell 72:741-752 (1993). RN [8] RA Singson A., Leviten M. W., Bang A. G., Hua X. H., Posakony J. W. RT Direct downstream targets of proneural activators RT in the imaginal disc include genes involved in lateral inhibitory signaling RL Genes Dev. 8:2058-2071 (1994). RN [9] RA Villares R., Cabrera C. V. RT The achaete-scute gene complex of D. melanogaster: RT conserved domains in a subset of genes required for RT neurogenesis and their homology to myc RL Cell 50:415-424 (1987). RN [10] RA Ellis H. M., Spann D. R., Posakony J. W. RT extramacrochaetae, a negative regulator of sensory RT organ development in Drosophila, defines a new class RT of helix-loop-helix proteins RL Cell 61:27-38 (1990). XX //

More Sample Inputs: Click on an Acc No. to view contents. (Not yet operational.)